DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galectin and GRIFIN

DIOPT Version :9

Sequence 1:NP_608487.1 Gene:galectin / 33162 FlyBaseID:FBgn0031213 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001381716.1 Gene:GRIFIN / 402635 HGNCID:4577 Length:144 Species:Homo sapiens


Alignment Length:125 Identity:39/125 - (31%)
Similarity:55/125 - (44%) Gaps:26/125 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 GKLSEGISFTVTGNLSVNCERFSINLVYNNDSRDVALHINPRLPQNYIVRNTKVQDIWGNEEVSS 208
            |.|:.|....|.|:.....:||..|.:.  ::.|:|.||.||.....:|.|......||.|:|||
Human    11 GGLAPGWKLLVQGHADSGEDRFETNFLL--ETGDIAFHIKPRFSSATVVGNAFQYGRWGPEQVSS 73

  Fly   209 ALPFLLSRGEEFSIQVLVTEACYMISVNGQHFAAYT--HRI---PYRD--------VRIL 255
            ..|  |:.||.|.|:|         |.:.:||..|.  |::   |.|.        ||:|
Human    74 IFP--LAPGEPFEIEV---------SWDAEHFHVYAPEHKVLQFPCRQRPLGATTRVRVL 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galectinNP_608487.1 GLECT 143..262 CDD:238025 39/125 (31%)
Gal-bind_lectin 339..479 CDD:278752
GRIFINNP_001381716.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D357844at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.