DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galectin and LGALS9

DIOPT Version :9

Sequence 1:NP_608487.1 Gene:galectin / 33162 FlyBaseID:FBgn0031213 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_033665.1 Gene:LGALS9 / 3965 HGNCID:6570 Length:355 Species:Homo sapiens


Alignment Length:401 Identity:109/401 - (27%)
Similarity:168/401 - (41%) Gaps:95/401 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 FKASFYEY-ADAVPKYFNDQI-GKLSEGISFTVTGN-LSVNCERFSINLVYNNDSRDVALHINPR 185
            |..|...| :.|||  |:..| |.|.:|:..||.|. ||.:..||::|........|:|.|.|||
Human     3 FSGSQAPYLSPAVP--FSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPR 65

  Fly   186 LPQ-NYIVRNTKVQDIWGNEEVSSALPFLLSRGEEFSIQVLVTEACYMISVNGQHFAAYTHRIPY 249
            ... .|:|.||:....||.||..:.:||  .:|..|.:..||..:.:.:.|||..|..|.||:|:
Human    66 FEDGGYVVCNTRQNGSWGPEERKTHMPF--QKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPF 128

  Fly   250 RDVRILEVKGDVS----NVEMKRTLVLK-------------YPERLPQSEANNIELHIDDGINEI 297
            ..|..:.|.|.|.    :.:..||:.::             :|.| |:....             
Human   129 HRVDTISVNGSVQLSYISFQNPRTVPVQPAFSTVPFSQPVCFPPR-PRGRRQ------------- 179

  Fly   298 DASVEETVKIPHEWCIISAPNTQS-----DSSPKRNNSSNDLGLTLPYYGALPP----------- 346
                    |.|..|....||.||:     .|:|.:..|:          .|:||           
Human   180 --------KPPGVWPANPAPITQTVIHTVQSAPGQMFST----------PAIPPMMYPHPAYPMP 226

  Fly   347 ------NSLVDGRCLKIEGRVRLLPHSFYINLQQGQDIWPHPVIAFHLNPRFSKASSGAIGKAVV 405
                  ..|...:.:.:.|.|......|:|||..|..      |||||||||.:       .|||
Human   227 FITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNH------IAFHLNPRFDE-------NAVV 278

  Fly   406 CRNAWLNGAWAQEERS-EFDTNFRPGRSFCLAIVCTKTSFEVYVNRQFMTDFKYKV-SPEVVDTV 468
             ||..::.:|..|||| .....|..|:||.:.|:|.....:|.|:.|.:.::.::: :...::.:
Human   279 -RNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRL 342

  Fly   469 YIQGDVKLWNV 479
            .:.||::|.:|
Human   343 EVGGDIQLTHV 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galectinNP_608487.1 GLECT 143..262 CDD:238025 43/121 (36%)
Gal-bind_lectin 339..479 CDD:278752 42/158 (27%)
LGALS9NP_033665.1 lectin domain 1..148 51/148 (34%)
GLECT 16..146 CDD:238025 46/133 (35%)
alternate exon 149..180 5/52 (10%)
Peptidase_C62 <154..214 CDD:289173 14/91 (15%)
link peptide 181..206 8/24 (33%)
lectin domain 207..355 44/171 (26%)
Gal-bind_lectin 233..354 CDD:214904 40/135 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150757
Domainoid 1 1.000 80 1.000 Domainoid score I8601
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 125 1.000 Inparanoid score I4712
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D357844at33208
OrthoFinder 1 1.000 - - FOG0000178
OrthoInspector 1 1.000 - - mtm8457
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4988
SonicParanoid 1 1.000 - - X133
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.830

Return to query results.
Submit another query.