DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galectin and LGALS3

DIOPT Version :9

Sequence 1:NP_608487.1 Gene:galectin / 33162 FlyBaseID:FBgn0031213 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001344607.1 Gene:LGALS3 / 3958 HGNCID:6563 Length:264 Species:Homo sapiens


Alignment Length:123 Identity:42/123 - (34%)
Similarity:61/123 - (49%) Gaps:9/123 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 TVTGNLSVNCERFSINLVYNNDSRDVALHINPRLPQN---YIVRNTKVQDIWGNEEVSSALPFLL 214
            |:.|.:..|..|.:::....|   |||.|.|||..:|   .||.|||:.:.||.||..|..||  
Human   147 TILGTVKPNANRIALDFQRGN---DVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPF-- 206

  Fly   215 SRGEEFSIQVLVTEACYMISVNGQHFAAYTHRI-PYRDVRILEVKGDVSNVEMKRTLV 271
            ..|:.|.|||||....:.::||..|...|.||: ...::..|.:.||:.......|::
Human   207 ESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galectinNP_608487.1 GLECT 143..262 CDD:238025 41/112 (37%)
Gal-bind_lectin 339..479 CDD:278752
LGALS3NP_001344607.1 DNA_pol3_gamma3 <23..127 CDD:331207
GLECT 131..258 CDD:238025 41/115 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 80 1.000 Domainoid score I8601
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.919607 Normalized mean entropy S5429
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D357844at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X133
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.770

Return to query results.
Submit another query.