DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galectin and LGALS2

DIOPT Version :10

Sequence 1:NP_608487.1 Gene:galectin / 33162 FlyBaseID:FBgn0031213 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_006489.1 Gene:LGALS2 / 3957 HGNCID:6562 Length:132 Species:Homo sapiens


Alignment Length:124 Identity:32/124 - (25%)
Similarity:58/124 - (46%) Gaps:6/124 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 LSEGISFTVTGNLSVNCERFSINLVYNNDSRDVALHINPRLPQNYIVRNTKVQDIWGNEEVSSAL 210
            :..|.:..:||:::...:.|.|||....|.  :.||.|||..::.||.|:.....||.|:....|
Human    12 MKPGSTLKITGSIADGTDGFVINLGQGTDK--LNLHFNPRFSESTIVCNSLDGSNWGQEQREDHL 74

  Fly   211 PFLLSRGEEFSIQVLVTEACYMISVNGQHFAAYTHRIPYRDVRILEVKG--DVSNVEMK 267
            .|  |.|.|....|......:.:.:...|...:.:|:.:..:..|.|:|  ::|:.::|
Human    75 CF--SPGSEVKFTVTFESDKFKVKLPDGHELTFPNRLGHSHLSYLSVRGGFNMSSFKLK 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galectinNP_608487.1 GLECT 143..262 CDD:238025 30/117 (26%)
Gal-bind_lectin 346..479 CDD:459768
LGALS2NP_006489.1 GLECT 11..129 CDD:238025 31/120 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.