DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galectin and lgals3

DIOPT Version :9

Sequence 1:NP_608487.1 Gene:galectin / 33162 FlyBaseID:FBgn0031213 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_988986.1 Gene:lgals3 / 394583 XenbaseID:XB-GENE-983743 Length:256 Species:Xenopus tropicalis


Alignment Length:114 Identity:36/114 - (31%)
Similarity:65/114 - (57%) Gaps:9/114 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 TVTGNLSVNCERFSINLVYNNDSRDVALHINPRLPQ--NYIVRNTKVQDIWGNEE-VSSALPFLL 214
            |:.|.::.|.:||:|:.   ....|:|:|||||..:  :.||||:.:.:.||:|| .:...||: 
 Frog   139 TIHGTVNPNAKRFAIDF---RRGHDIAMHINPRFDERPHVIVRNSMIHNKWGHEERHAQKFPFV- 199

  Fly   215 SRGEEFSIQVLVTEACYMISVNGQHFAAYTHRI-PYRDVRILEVKGDVS 262
             .|:.|.:||:.....|.:::|.:....|.||: ...::|.:.:.|||:
 Frog   200 -AGQPFKLQVMCEADHYKVAINNETLFQYVHRVKELHEIRSVCIAGDVT 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galectinNP_608487.1 GLECT 143..262 CDD:238025 35/112 (31%)
Gal-bind_lectin 339..479 CDD:278752
lgals3NP_988986.1 PABP-1234 <61..136 CDD:130689
Gal-bind_lectin 129..252 CDD:214904 36/114 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 73 1.000 Domainoid score I9049
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D357844at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X133
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.