DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galectin and lgals2b

DIOPT Version :9

Sequence 1:NP_608487.1 Gene:galectin / 33162 FlyBaseID:FBgn0031213 Length:503 Species:Drosophila melanogaster
Sequence 2:XP_005172121.1 Gene:lgals2b / 393486 ZFINID:ZDB-GENE-040426-1590 Length:132 Species:Danio rerio


Alignment Length:123 Identity:37/123 - (30%)
Similarity:61/123 - (49%) Gaps:9/123 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 GISFTVTGNLSVNCERFSINLVYNNDSRDVALHINPRL----PQNYIVRNTKVQDIWGNEEVSSA 209
            |:...::|.:...|:.||||:.:::|:  :|||.|||.    ..|.||.|:| |..||:|.....
Zfish    13 GMEMKISGKVKPGCDAFSINIGHDDDA--IALHFNPRFNAHGDSNTIVCNSK-QGGWGSEHREHC 74

  Fly   210 LPFLLSRGEEFSIQVLVTEACYMISVNGQHFAAYTHRIPYRDVRILEVKGDVSNVEMK 267
            .||  .:||||.:.:......:.|.:......::.:|........:.|||||..:.:|
Zfish    75 FPF--QQGEEFKLSITFNNETFYIKLPEGTMMSFPNRFGDDAFSHVHVKGDVKIISVK 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galectinNP_608487.1 GLECT 143..262 CDD:238025 35/116 (30%)
Gal-bind_lectin 339..479 CDD:278752
lgals2bXP_005172121.1 GLECT 9..130 CDD:238025 36/121 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.