DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galectin and lgalslb

DIOPT Version :9

Sequence 1:NP_608487.1 Gene:galectin / 33162 FlyBaseID:FBgn0031213 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001007175.1 Gene:lgalslb / 368889 ZFINID:ZDB-GENE-030616-570 Length:145 Species:Danio rerio


Alignment Length:116 Identity:31/116 - (26%)
Similarity:55/116 - (47%) Gaps:13/116 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   366 HSFYINLQQGQDIWPHPV----IAFHLNPRFSKASSGAIGKAVVCRNAWLNGAWAQEERSEFDTN 426
            |||.|:|..|.:......    :|..|:.||::..        ..|||.::|.|::||.......
Zfish    34 HSFDISLTCGHNEEKEDEKLADVALKLSARFTERQ--------FLRNARVSGKWSEEEAPIAYFP 90

  Fly   427 FRPGRSFCLAIVCTKTSFEVYVNRQFMTDFKYKV-SPEVVDTVYIQGDVKL 476
            |.|.:.|.:.|.|....|.::|:...:.||.:|| |.:.::.:.|.|.:::
Zfish    91 FIPDQPFRIEIHCEHQRFRIFVDGHQLFDFYHKVKSLQAINMIRIVGSLQI 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galectinNP_608487.1 GLECT 143..262 CDD:238025
Gal-bind_lectin 339..479 CDD:278752 31/116 (27%)
lgalslbNP_001007175.1 Gal-bind_lectin 34..143 CDD:214904 31/116 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D357844at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.