DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galectin and CG13950

DIOPT Version :9

Sequence 1:NP_608487.1 Gene:galectin / 33162 FlyBaseID:FBgn0031213 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001334728.1 Gene:CG13950 / 33267 FlyBaseID:FBgn0031289 Length:316 Species:Drosophila melanogaster


Alignment Length:333 Identity:66/333 - (19%)
Similarity:117/333 - (35%) Gaps:87/333 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 VTGNLSVNCERFSINLVYN----NDSRDVALHINPRLPQNYIVRNT-KVQDIWGNEEVSS----- 208
            |:|.:..:..:.|::|..|    |:|..|.|.|.....:..|:|:. :....|..||:|.     
  Fly    20 VSGRVKPHPNKISLDLTDNVNAQNESETVFLKIEANFREGQIIRSMFQPGGGWQQEEISKNWKCD 84

  Fly   209 --ALPFLLSRGEEFSIQVLVTEACYMISVNGQHFAAYTH-RIPYRDVRILEVKGDVSNVEMKRTL 270
              ..|  |..|:.|:.:|.|.:.|:.|.||.|.:.::.. :.| :.:..:...||...:......
  Fly    85 GPKNP--LQPGQSFTFRVAVLQRCFEIYVNDQLYGSFEFVKFP-KQINYVRTYGDFEKITQFHHR 146

  Fly   271 VLKYPERLPQSEANNIELHIDDGI---NEIDASVEETVKIPHEWCIISAPNTQSDSSPKRNNSSN 332
            :| :|...|::      |...|.:   :::....|....:..| ||...|.|...|...:   .|
  Fly   147 ML-FPLVFPRT------LMCPDKVAFQSDVPRRYETGTVVAME-CIAKGPPTTEFSICFQ---CN 200

  Fly   333 DLGLTLPYYGALPPNSLVDGRCLKIEGRVRLLPHSFYINLQQGQDIWPHPVIAFHLNPRFSKASS 397
            |.|.|                                             |:.||:|        
  Fly   201 DTGRT---------------------------------------------VLRFHVN-------- 212

  Fly   398 GAIGKAVVCRNAWL--NGAWAQEERSEFDTNFRPGRSFCLAIVCTKTSFEVYVNRQFMTDFKYKV 460
              ..:..|.|:...  |.....:|.:|.:..|..|:.|.:|......:|.:.||.|:.|.:.:..
  Fly   213 --FDRTTVSRSYQREDNSFALSDEETEGEFPFVRGKLFKIAFGLGDRAFLIAVNGQYFTYYNFPG 275

  Fly   461 SPEVVDTV 468
            .|..:.|:
  Fly   276 RPFSISTL 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galectinNP_608487.1 GLECT 143..262 CDD:238025 30/120 (25%)
Gal-bind_lectin 339..479 CDD:278752 20/132 (15%)
CG13950NP_001334728.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464271
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3587
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11346
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.