DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galectin and lgals3b

DIOPT Version :10

Sequence 1:NP_608487.1 Gene:galectin / 33162 FlyBaseID:FBgn0031213 Length:503 Species:Drosophila melanogaster
Sequence 2:XP_073783081.1 Gene:lgals3b / 325599 ZFINID:ZDB-GENE-030131-4324 Length:238 Species:Danio rerio


Alignment Length:151 Identity:51/151 - (33%)
Similarity:77/151 - (50%) Gaps:13/151 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 LTLPYYGALPPNSLVDGRCLKIEGRVRLLPHSFYINLQQGQDIWPHPVIAFHLNPRFSKASSGAI 400
            ||:|....| .|...:...:.|.|.|:.....|.:||::|.|      ||||:|||||:.     
Zfish   100 LTVPLDFPL-QNGAYNKMLITINGEVKPNAKQFTVNLRRGND------IAFHINPRFSEG----- 152

  Fly   401 GKAVVCRNAWLNGAWAQEERSEFDTNFRPGRSFCLAIVCTKTSFEVYVNRQFMTDFKYKV-SPEV 464
            ||.|:.||:.:...|.:|||......|.||:.|.:.|:.|.|.::|.||:..:.:||::| ....
Zfish   153 GKPVIVRNSMIGNNWGREERELPSFPFVPGKPFEMKILITDTEYKVAVNKSHLLEFKHRVFELNQ 217

  Fly   465 VDTVYIQGDVKLWNVTLEKNQ 485
            :..:.|..||.|..|.:|..|
Zfish   218 ITGLSIYNDVTLSTVNVETLQ 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galectinNP_608487.1 GLECT 143..262 CDD:238025
Gal-bind_lectin 346..479 CDD:459768 44/133 (33%)
lgals3bXP_073783081.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.