DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galectin and LGALSL

DIOPT Version :9

Sequence 1:NP_608487.1 Gene:galectin / 33162 FlyBaseID:FBgn0031213 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_054900.2 Gene:LGALSL / 29094 HGNCID:25012 Length:172 Species:Homo sapiens


Alignment Length:190 Identity:43/190 - (22%)
Similarity:78/190 - (41%) Gaps:38/190 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   290 IDDG--INEIDASVEETVKIPHEWCIISAPNTQSDSSPKRNNSSNDLGLTLPYYGALPPNSLVDG 352
            :|||  .|.:.:.|:..|..|.                          |.:|:.|.: ...:..|
Human    14 LDDGHLNNSLSSPVQADVYFPR--------------------------LIVPFCGHI-KGGMRPG 51

  Fly   353 RCLKIEGRVRLLPHSFYINLQQGQDIWPHPVIAFHLNPRFSKASSGAIGKAVVCRNAWLNGAWAQ 417
            :.:.:.|.|.|.|.||.|:|..|....|...:|..|...|:...        :.||:.::|...:
Human    52 KKVLVMGIVDLNPESFAISLTCGDSEDPPADVAIELKAVFTDRQ--------LLRNSCISGERGE 108

  Fly   418 EERSEFDTNFRPGRSFCLAIVCTKTSFEVYVNRQFMTDFKYKVSP-EVVDTVYIQGDVKL 476
            |:.:.....|.|.:.|.:.|:|....|.|:|:...:.||.:::.. ..:||:.|.||:::
Human   109 EQSAIPYFPFIPDQPFRVEILCEHPRFRVFVDGHQLFDFYHRIQTLSAIDTIKINGDLQI 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galectinNP_608487.1 GLECT 143..262 CDD:238025
Gal-bind_lectin 339..479 CDD:278752 35/139 (25%)
LGALSLNP_054900.2 Gal-bind_lectin 46..170 CDD:214904 33/131 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 77 1.000 Domainoid score I8848
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D357844at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.780

Return to query results.
Submit another query.