DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galectin and Lgals5

DIOPT Version :9

Sequence 1:NP_608487.1 Gene:galectin / 33162 FlyBaseID:FBgn0031213 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_037108.1 Gene:Lgals5 / 25475 RGDID:3004 Length:145 Species:Rattus norvegicus


Alignment Length:139 Identity:53/139 - (38%)
Similarity:81/139 - (58%) Gaps:15/139 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 AVPKYFNDQIGKLSEGISFTVTGNLSVNCERFSINLVYNNDSRDVALHINPRLPQNYIVRNTKVQ 198
            ||| :|......|....|..::|.:..:.:||.|||   ....|:|.|:|||..:|.:||||::.
  Rat    14 AVP-FFTSIPNGLYPSKSIVISGVVLSDAKRFQINL---RCGGDIAFHLNPRFDENAVVRNTQIN 74

  Fly   199 DIWGNEEVS--SALPFLLSRGEEFSIQVLVTEACYMISVNGQHFAAYTHR---IPYRDVRILEVK 258
            :.||.||.|  .::||  |||:.||:.:|....|:.::|:|||...|:||   :|  |:..|||.
  Rat    75 NSWGPEERSLPGSMPF--SRGQRFSVWILCEGHCFKVAVDGQHICEYSHRLMNLP--DINTLEVA 135

  Fly   259 GDV--SNVE 265
            ||:  ::||
  Rat   136 GDIQLTHVE 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galectinNP_608487.1 GLECT 143..262 CDD:238025 47/125 (38%)
Gal-bind_lectin 339..479 CDD:278752
Lgals5NP_037108.1 Gal-bind_lectin 22..144 CDD:214904 47/128 (37%)
Beta-galactoside binding. /evidence=ECO:0000255 77..83 4/5 (80%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 86 1.000 Domainoid score I7884
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D357844at33208
OrthoFinder 1 1.000 - - FOG0000178
OrthoInspector 1 1.000 - - mtm8932
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X133
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.