DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galectin and F49F1.18

DIOPT Version :9

Sequence 1:NP_608487.1 Gene:galectin / 33162 FlyBaseID:FBgn0031213 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001294425.1 Gene:F49F1.18 / 24104609 WormBaseID:WBGene00235368 Length:195 Species:Caenorhabditis elegans


Alignment Length:159 Identity:42/159 - (26%)
Similarity:66/159 - (41%) Gaps:43/159 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   304 TVKIPHEWCIISAPNTQSDSSPKRNNSSNDLGLTLPYYGALPPNSLVDGRCLKIEGRVRLLPHS- 367
            |.|...:|...:.|.|                .|||    :|......|:.::|.|    :|.: 
 Worm    52 TSKPREDWITFNGPFT----------------TTLP----IPGGYWDTGKIIRIHG----VPGTG 92

  Fly   368 -FYINLQQGQDIWPHPVIAFHLNPRFSKASSGAIGKAVVCRNAWLNGAWAQEERSEFDTN-FRPG 430
             :.|||.|.      .|..|||:   |:.|.|     :|.||.:|||||..||:  :..| |...
 Worm    93 RWTINLVQA------GVRLFHLS---SEPSKG-----LVVRNRFLNGAWQVEEK--WGGNPFPVS 141

  Fly   431 RSFCLAIVCTKTSFEVYVNRQFMTDFKYK 459
            ..|.:.::...:..|::||..|..:|.::
 Worm   142 TPFNVTLINQPSHIEIHVNGVFFVNFNHR 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galectinNP_608487.1 GLECT 143..262 CDD:238025
Gal-bind_lectin 339..479 CDD:278752 35/124 (28%)
F49F1.18NP_001294425.1 GLECT 69..194 CDD:214596 37/126 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D357844at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.