DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galectin and F49F1.11

DIOPT Version :10

Sequence 1:NP_608487.1 Gene:galectin / 33162 FlyBaseID:FBgn0031213 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_500492.2 Gene:F49F1.11 / 186067 WormBaseID:WBGene00018651 Length:227 Species:Caenorhabditis elegans


Alignment Length:160 Identity:42/160 - (26%)
Similarity:62/160 - (38%) Gaps:43/160 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   304 TVKIPHEWCIISAPNTQSDSSPKRNNSSNDLGLTLPYYGALPPNSLVDGRCLKIEGRVRLLPHS- 367
            |.|...:|..|:.|.|                .|||    :|......|:.::|.|    .|.: 
 Worm    84 TPKPREDWITINGPFT----------------TTLP----IPGGYWDTGKIMRIYG----TPGAG 124

  Fly   368 -FYINLQQGQDIWPHPVIAFHLNPRFSKASSGAIGKAVVCRNAWLNGAWAQEERSEFDTN-FRPG 430
             :.|||.:.: :|     .||.      ||...  |.:|.|....||||  |....:..| ||..
 Worm   125 RWTINLAKSK-VW-----VFHF------ASEPT--KGLVARTRHTNGAW--EVGETYGGNPFRAN 173

  Fly   431 RSFCLAIVCTKTSFEVYVNRQFMTDFKYKV 460
            ..|.:.:|...|..|::||..|..:|.::|
 Worm   174 TYFNVTMVNQPTHIEIHVNGAFFVNFNHRV 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galectinNP_608487.1 GLECT 143..262 CDD:238025
Gal-bind_lectin 346..479 CDD:459768 32/118 (27%)
F49F1.11NP_500492.2 GLECT 101..226 CDD:214596 36/127 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.