DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galectin and F49F1.10

DIOPT Version :10

Sequence 1:NP_608487.1 Gene:galectin / 33162 FlyBaseID:FBgn0031213 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_500491.1 Gene:F49F1.10 / 186066 WormBaseID:WBGene00018650 Length:215 Species:Caenorhabditis elegans


Alignment Length:152 Identity:43/152 - (28%)
Similarity:65/152 - (42%) Gaps:27/152 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   317 PNTQSDSSPKRNNSSNDLGLTL--PYYGALP-PNSLVD-GRCLKIEGRVRLLPHS--FYINLQQG 375
            |.....|.|.......|..:|:  |:...|| |....| |:.::|.|    :|.|  :.|||.:.
 Worm    52 PRPPRPSKPVTTPKPRDDWITINGPFTTTLPIPGGYWDTGKIMRIYG----IPGSGRWTINLAKS 112

  Fly   376 QDIWPHPVIAFHLNPRFSKASSGAIGKAVVCRNAWLNGAWAQEERSEFDTN-FRPGRSFCLAIVC 439
            : :|   |..|.:.|          .|.:|.|...|||.|...|  .:..| ||...:|.:.:|.
 Worm   113 K-VW---VFHFAVEP----------SKGLVARTRHLNGKWQVGE--TYGGNPFRANAAFNVTMVN 161

  Fly   440 TKTSFEVYVNRQFMTDFKYKVS 461
            ..|..|::||..|..:|.::||
 Worm   162 QPTHIEIHVNGAFFVNFNHRVS 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galectinNP_608487.1 GLECT 143..262 CDD:238025
Gal-bind_lectin 346..479 CDD:459768 35/120 (29%)
F49F1.10NP_500491.1 GLECT 80..204 CDD:214596 37/124 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.