DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galectin and F46A8.5

DIOPT Version :10

Sequence 1:NP_608487.1 Gene:galectin / 33162 FlyBaseID:FBgn0031213 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_492883.1 Gene:F46A8.5 / 185821 WormBaseID:WBGene00009748 Length:218 Species:Caenorhabditis elegans


Alignment Length:179 Identity:43/179 - (24%)
Similarity:77/179 - (43%) Gaps:46/179 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   318 NTQSDSSPKRNNSSN-------DLGLTLPYYGALPPNSLVDGRCLKIEGRVRLLPHSFYINLQQG 375
            |.::.:.|..:||..       |.|..|.:||       |.|     :||       :.|||.||
 Worm    78 NMETINGPFGSNSRIPIPGGYWDTGKVLRFYG-------VPG-----QGR-------WSINLAQG 123

  Fly   376 QDIWPHPVIAFHLNPRFSKASSGAIGKAVVCRNAWLNGAWAQEERSEFDTN-FRPGRSFCLAIVC 439
             .:|           .|..||...:|:.|..|:.  ||.:.|.:  .:..| |..|.:|.:.::.
 Worm   124 -IVW-----------LFRFASQPDLGRVVRTRHQ--NGQFLQGD--TYGGNPFPAGANFNVTMIN 172

  Fly   440 TKTSFEVYVNRQFMTDFKYKVSPEVVDTVYIQGDVKLWNVTLEKNQMIK 488
            ..::.|::||:.|.|::.::......|..:|  |: :.||.:.|.::.:
 Worm   173 QPSAIEIHVNQVFFTNYNHRTGNPSRDYQFI--DI-IENVIISKIEITR 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galectinNP_608487.1 GLECT 143..262 CDD:238025
Gal-bind_lectin 346..479 CDD:459768 31/133 (23%)
F46A8.5NP_492883.1 GLECT 91..217 CDD:214596 39/163 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.