DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galectin and F38A5.8

DIOPT Version :10

Sequence 1:NP_608487.1 Gene:galectin / 33162 FlyBaseID:FBgn0031213 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_501014.1 Gene:F38A5.8 / 185444 WormBaseID:WBGene00018165 Length:130 Species:Caenorhabditis elegans


Alignment Length:76 Identity:18/76 - (23%)
Similarity:26/76 - (34%) Gaps:19/76 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 EVKGDVSNVEMKRTLVLKYPERLPQSEANNIELHIDDGINEIDASVEETVKIPHEWCIISAPNTQ 320
            ||.|.|.:|.   .|....|..:|.|                ..:|...||...:....:|..|:
 Worm     7 EVIGPVYSVP---PLASPMPTMVPPS----------------PLAVTPKVKKDEDSGSSAAETTR 52

  Fly   321 SDSSPKRNNSS 331
            :....||.|:|
 Worm    53 AGKHRKRTNAS 63

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galectinNP_608487.1 GLECT 143..262 CDD:238025 3/5 (60%)
Gal-bind_lectin 346..479 CDD:459768
F38A5.8NP_501014.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.