DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galectin and lec-9

DIOPT Version :9

Sequence 1:NP_608487.1 Gene:galectin / 33162 FlyBaseID:FBgn0031213 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_510844.1 Gene:lec-9 / 181786 WormBaseID:WBGene00002272 Length:140 Species:Caenorhabditis elegans


Alignment Length:135 Identity:41/135 - (30%)
Similarity:70/135 - (51%) Gaps:11/135 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 AVPKYFNDQIGKLSEGISFTVTGNLSVNCERFSINLVYNNDSRDVALHINPRLPQNYIVR-NTKV 197
            :||..|....| :..|:...|.| |..:.:.|.:||:   ...::|||:|.|..:..||. |.|:
 Worm     9 SVPGTFALPFG-VRSGLQIAVNG-LVKHKKDFVVNLI---SGGNIALHVNFRFEKQKIVAINAKI 68

  Fly   198 QDIWGNEEVSSALPFLLSRGEEFSIQVLVTEACYMISVNGQHFAAYTHRIPYRDVRILEVKGDV- 261
            .:.||| |:|.|.|  |...:.|.:|:.|....:.|:.||.....:.||:|:..::.:.::|.| 
 Worm    69 DNAWGN-EISHANP--LHHDQAFDLQIRVYPGYFHITTNGVLLGDFPHRLPFESIQAINLEGKVH 130

  Fly   262 -SNVE 265
             :||:
 Worm   131 INNVQ 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galectinNP_608487.1 GLECT 143..262 CDD:238025 36/121 (30%)
Gal-bind_lectin 339..479 CDD:278752
lec-9NP_510844.1 GLECT 13..137 CDD:214596 39/131 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.919607 Normalized mean entropy S5429
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D829777at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.770

Return to query results.
Submit another query.