DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galectin and lec-7

DIOPT Version :10

Sequence 1:NP_608487.1 Gene:galectin / 33162 FlyBaseID:FBgn0031213 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001379074.1 Gene:lec-7 / 181199 WormBaseID:WBGene00002270 Length:179 Species:Caenorhabditis elegans


Alignment Length:138 Identity:38/138 - (27%)
Similarity:63/138 - (45%) Gaps:13/138 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 VPKYFNDQIGK-LSEGISFTVTGN-LSVNCERFSINLVYNNDSRDVALHINPRL-PQNYIVRNTK 196
            ||..:  ||.: |..|:...|.|. |..|...|:|.|:   ...::.||:.... .::.||.|:.
 Worm     9 VPSVY--QIEENLKAGVEIEVNGAVLHGNDRDFAIELL---SGTNIVLHVKFEFNGEHSIVLNSL 68

  Fly   197 VQDIWGNEEVSSALPFLLSRGEEFSIQVLVTEACYMISVNGQHFAAYTHRIPYRDVRILEVKG-- 259
            :...||.:...|   ..|.|.:.|.:::.|.|..|.|:||......:.||.|...|:.:.:||  
 Worm    69 INGEWGPQLRHS---HFLKRHDPFHVRIYVHEGYYNITVNSDLLVEFDHRFPVVAVQGIGIKGSV 130

  Fly   260 DVSNVEMK 267
            |:.::..|
 Worm   131 DIESIVFK 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galectinNP_608487.1 GLECT 143..262 CDD:238025 34/123 (28%)
Gal-bind_lectin 346..479 CDD:459768
lec-7NP_001379074.1 GLECT 15..137 CDD:214596 34/127 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.