DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galectin and Lgals7

DIOPT Version :9

Sequence 1:NP_608487.1 Gene:galectin / 33162 FlyBaseID:FBgn0031213 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_032522.2 Gene:Lgals7 / 16858 MGIID:1316742 Length:136 Species:Mus musculus


Alignment Length:114 Identity:41/114 - (35%)
Similarity:60/114 - (52%) Gaps:3/114 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 GISFTVTGNLSVNCERFSINLVYNND-SRDVALHINPRLPQNYIVRNTKVQDIWGNEEVSSALPF 212
            |....:.|.:.....||.:||:...: ..|.|||.||||..:.:|.|||.|..||.||..:.:||
Mouse    17 GTVMRIRGMVPDQAGRFHVNLLCGEEQGADAALHFNPRLDTSEVVFNTKEQGKWGREERGTGIPF 81

  Fly   213 LLSRGEEFSIQVLVTEACYMISVNGQHFAAYTHRIPYRDVRILEVKGDV 261
              .||:.|.:.::.||..:...|....:..:.||:|...||::||.|||
Mouse    82 --ERGQPFEVLLIATEEGFKAVVGDDEYLHFHHRMPPARVRLVEVGGDV 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galectinNP_608487.1 GLECT 143..262 CDD:238025 41/114 (36%)
Gal-bind_lectin 339..479 CDD:278752
Lgals7NP_032522.2 Gal-bind_lectin 5..133 CDD:366037 41/114 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167840830
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000178
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X133
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.740

Return to query results.
Submit another query.