DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galectin and Lgals6

DIOPT Version :9

Sequence 1:NP_608487.1 Gene:galectin / 33162 FlyBaseID:FBgn0031213 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_034837.2 Gene:Lgals6 / 16857 MGIID:107535 Length:301 Species:Mus musculus


Alignment Length:338 Identity:108/338 - (31%)
Similarity:149/338 - (44%) Gaps:71/338 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 GKLSEGISFTVTGNLSVNCERFSINL-VYNNDSRDVALHINPRLP-QNYIVRNTKVQDIWGNEEV 206
            |.||.|:||.:.|....|..||.:|. |..:|..|||.|.|||.. .:.:|.|||....||.||.
Mouse    25 GGLSVGMSFYIQGTAKENMRRFHVNFAVGQDDGADVAFHFNPRFDGWDKVVFNTKQSGRWGKEEE 89

  Fly   207 SSALPFLLSRGEEFSIQVLVTEACYMISVNGQHFAAYTHRIPYRDVRILEVKGDVSNVEMKRTLV 271
            .| :||  .:|:.|.:..:|....|.:.|||..|..|.||:|.:.|..|:|.||           
Mouse    90 KS-MPF--QKGKHFELVFMVMPEHYKVVVNGSPFYEYGHRLPVQMVTHLQVDGD----------- 140

  Fly   272 LKYPERLPQSEANNIELHIDDGINEIDASVEETVKIPHEWCIISAPNTQSDSSPKRNNSSNDLGL 336
                          :||   ..||.......|| |.|    .::.|       |..|.       
Mouse   141 --------------LEL---QSINFFGVQPVET-KYP----AMTGP-------PVFNP------- 169

  Fly   337 TLPYYGALPPNSLVDGRCLKIEGRVRLLPHSFYINLQQG--QDIWPHPVIAFHLNPRFSKASSGA 399
            .|||.|||.....| .|.:.|:|.|.....:|.||.:.|  :|      ||.|:|||        
Mouse   170 CLPYVGALQGGFTV-RRTIIIKGYVLPTAKTFAINFRVGSSED------IALHINPR-------- 219

  Fly   400 IGKAVVCRNAWLNGAWAQEERSEFDTNFRPGRSFCLAIVCTKTSFEVYVNRQFMTDFKYKVSP-E 463
            ||..:| ||:::||:|..|||......|.||:.|.|:|.|....|:|:.|...:.:|.::... .
Mouse   220 IGDCLV-RNSYMNGSWGTEERMVAYNPFGPGQFFDLSIRCGMDRFKVFANGIHLFNFSHRFQALR 283

  Fly   464 VVDTVYIQGDVKL 476
            .::|:.|.||:.|
Mouse   284 KINTLEINGDLTL 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galectinNP_608487.1 GLECT 143..262 CDD:238025 48/119 (40%)
Gal-bind_lectin 339..479 CDD:278752 48/141 (34%)
Lgals6NP_034837.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 73 1.000 Domainoid score I9193
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 129 1.000 Inparanoid score I4628
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000178
OrthoInspector 1 1.000 - - mtm8697
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11346
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X133
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.060

Return to query results.
Submit another query.