DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galectin and Lgals3

DIOPT Version :9

Sequence 1:NP_608487.1 Gene:galectin / 33162 FlyBaseID:FBgn0031213 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001139425.1 Gene:Lgals3 / 16854 MGIID:96778 Length:264 Species:Mus musculus


Alignment Length:123 Identity:43/123 - (34%)
Similarity:61/123 - (49%) Gaps:9/123 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 TVTGNLSVNCERFSINLVYNNDSRDVALHINPRLPQN---YIVRNTKVQDIWGNEEVSSALPFLL 214
            |:.|.:..|..|..::....|   |||.|.|||..:|   .||.|||..:.||.||..||.||  
Mouse   147 TIMGTVKPNANRIVLDFRRGN---DVAFHFNPRFNENNRRVIVCNTKQDNNWGKEERQSAFPF-- 206

  Fly   215 SRGEEFSIQVLVTEACYMISVNGQHFAAYTHRIP-YRDVRILEVKGDVSNVEMKRTLV 271
            ..|:.|.|||||....:.::||..|...|.||:. .|::..|.:.||::.......::
Mouse   207 ESGKPFKIQVLVEADHFKVAVNDAHLLQYNHRMKNLREISQLGISGDITLTSANHAMI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galectinNP_608487.1 GLECT 143..262 CDD:238025 43/112 (38%)
Gal-bind_lectin 339..479 CDD:278752
Lgals3NP_001139425.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..105
Bindin 18..>110 CDD:251078
9 X 9 AA tandem repeats of Y-P-G-X(3)-P-[GS]-A 35..114
Gal-bind_lectin 137..258 CDD:214904 43/115 (37%)
Beta-galactoside binding. /evidence=ECO:0000250 195..201 4/5 (80%)
Nuclear export signal 240..255 4/14 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 89 1.000 Domainoid score I7822
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.919607 Normalized mean entropy S5429
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D357844at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X133
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.770

Return to query results.
Submit another query.