DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galectin and LGALS16

DIOPT Version :10

Sequence 1:NP_608487.1 Gene:galectin / 33162 FlyBaseID:FBgn0031213 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001177370.2 Gene:LGALS16 / 148003 HGNCID:40039 Length:142 Species:Homo sapiens


Alignment Length:121 Identity:36/121 - (29%)
Similarity:62/121 - (51%) Gaps:7/121 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 LSEGISFTVTGNL---SVNCERFSINLVYN-NDSRDVALHINPRLPQNYIVRNTKVQDIWGNEEV 206
            ||.|....:.|.|   |:|..:..::.... |:..::|.|:...|.:. :|.|::...||..||.
Human    14 LSVGSCVIIKGTLIDSSINEPQLQVDFYTEMNEDSEIAFHLRVHLGRR-VVMNSREFGIWMLEEN 77

  Fly   207 SSALPFLLSRGEEFSIQVLVTEACYMISVNGQHFAAYTHRIPYRDVRILEVKGDVS 262
            ...:||  ..|:.|.:::.|....|.:.|||::..|:.||||...|::::|..|||
Human    78 LHYVPF--EDGKPFDLRIYVCHNEYEVKVNGEYIYAFVHRIPPSYVKMIQVWRDVS 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galectinNP_608487.1 GLECT 143..262 CDD:238025 34/119 (29%)
Gal-bind_lectin 346..479 CDD:459768
LGALS16NP_001177370.2 Gal-bind_lectin 11..135 CDD:214904 36/121 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.