DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galectin and M6.11

DIOPT Version :10

Sequence 1:NP_608487.1 Gene:galectin / 33162 FlyBaseID:FBgn0031213 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001256974.1 Gene:M6.11 / 13219106 WormBaseID:WBGene00206478 Length:139 Species:Caenorhabditis elegans


Alignment Length:149 Identity:35/149 - (23%)
Similarity:55/149 - (36%) Gaps:28/149 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   337 TLPYYGALPPNS--LVDGRCLKIEGRVRLLPHSFYINLQQGQDIWPHPVIAFHL-NPRFSKASSG 398
            ||..|..:.|.:  |..|||         ...:|.|.|...|:|  ...|.|:| |.:...|.| 
 Worm    12 TLKIYKPIRPRTRFLFTGRC---------ETQNFSIALISSQEI--AMFIEFNLENTKLVSAKS- 64

  Fly   399 AIGKAVVCRNAWLNGAWAQEERSEFDTNFRPGRSFCLAIVCTKTSFEVYVNRQFMTDFKYKVSPE 463
                  .....|.....|:....:.||       |.:.|:.|...|||:....|:...||.|..|
 Worm    65 ------FSSKTWSREVLAKNPIQQNDT-------FFIQIITTNDHFEVFSGGTFIFSLKYTVPLE 116

  Fly   464 VVDTVYIQGDVKLWNVTLE 482
            .:..:.:...::::...:|
 Worm   117 KITGIRLMESMEMYEFEME 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galectinNP_608487.1 GLECT 143..262 CDD:238025
Gal-bind_lectin 346..479 CDD:459768 31/135 (23%)
M6.11NP_001256974.1 GLECT 12..123 CDD:469601 34/135 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.