DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galectin and M6.11

DIOPT Version :9

Sequence 1:NP_608487.1 Gene:galectin / 33162 FlyBaseID:FBgn0031213 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001256974.1 Gene:M6.11 / 13219106 WormBaseID:WBGene00206478 Length:139 Species:Caenorhabditis elegans


Alignment Length:149 Identity:35/149 - (23%)
Similarity:55/149 - (36%) Gaps:28/149 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   337 TLPYYGALPPNS--LVDGRCLKIEGRVRLLPHSFYINLQQGQDIWPHPVIAFHL-NPRFSKASSG 398
            ||..|..:.|.:  |..|||         ...:|.|.|...|:|  ...|.|:| |.:...|.| 
 Worm    12 TLKIYKPIRPRTRFLFTGRC---------ETQNFSIALISSQEI--AMFIEFNLENTKLVSAKS- 64

  Fly   399 AIGKAVVCRNAWLNGAWAQEERSEFDTNFRPGRSFCLAIVCTKTSFEVYVNRQFMTDFKYKVSPE 463
                  .....|.....|:....:.||       |.:.|:.|...|||:....|:...||.|..|
 Worm    65 ------FSSKTWSREVLAKNPIQQNDT-------FFIQIITTNDHFEVFSGGTFIFSLKYTVPLE 116

  Fly   464 VVDTVYIQGDVKLWNVTLE 482
            .:..:.:...::::...:|
 Worm   117 KITGIRLMESMEMYEFEME 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galectinNP_608487.1 GLECT 143..262 CDD:238025
Gal-bind_lectin 339..479 CDD:278752 32/142 (23%)
M6.11NP_001256974.1 GLECT 12..123 CDD:294054 34/135 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.