DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galectin and LOC1275208

DIOPT Version :10

Sequence 1:NP_608487.1 Gene:galectin / 33162 FlyBaseID:FBgn0031213 Length:503 Species:Drosophila melanogaster
Sequence 2:XP_314441.2 Gene:LOC1275208 / 1275208 VectorBaseID:AGAMI1_011833 Length:143 Species:Anopheles gambiae


Alignment Length:116 Identity:38/116 - (32%)
Similarity:60/116 - (51%) Gaps:8/116 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 TVTGNLSVNCERFSINL---VYNNDSRDVALHINPRLPQNYIVRNTKVQDIWGNEEVSSALPFLL 214
            |:.|.::  .::|:|||   ...|...|.||||:.|.....|:||:.....||.||.....|  :
Mosquito    28 TIRGRMT--HDQFNINLQTGPNTNPRDDTALHISIRPRDGVIIRNSIQFRNWGIEERFGGCP--V 88

  Fly   215 SRGEEFSIQVLVTEACYMISVNGQHFAAYTHRIPYRDVRILEVKGDVSNVE 265
            .:...|.:.:.|....|.|:|||.|:..:.||:||..||.:.: |:.:||:
Mosquito    89 QKKSYFDVTITVKPDSYGIAVNGAHYCDFNHRMPYASVRFVHI-GEGANVD 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galectinNP_608487.1 GLECT 143..262 CDD:238025 36/111 (32%)
Gal-bind_lectin 346..479 CDD:459768
LOC1275208XP_314441.2 Gal-bind_lectin 18..140 CDD:459768 38/116 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.