DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galectin and CLC

DIOPT Version :9

Sequence 1:NP_608487.1 Gene:galectin / 33162 FlyBaseID:FBgn0031213 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001819.2 Gene:CLC / 1178 HGNCID:2014 Length:142 Species:Homo sapiens


Alignment Length:156 Identity:45/156 - (28%)
Similarity:70/156 - (44%) Gaps:26/156 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 LTLPYYGALPPNSLVDGRCLKIEGRVRLLPHSFYINLQQGQDIWPHPVIAFHLNPRFSKASSGAI 400
            |.:||..|.   ||..|..:.|:||    |.:.::|       .|:..:.||..   .|..|..:
Human     4 LPVPYTEAA---SLSTGSTVTIKGR----PLACFLN-------EPYLQVDFHTE---MKEESDIV 51

  Fly   401 GKAVVC--RNAWLN----GAWAQEERSEFDTNFRPGRSFCLAIVCTKTSFEVYVNRQFMTDFKYK 459
            ....||  |...:|    |||.|:..|: :..|:.|:.|.|:|......::|.||.|....|.::
Human    52 FHFQVCFGRRVVMNSREYGAWKQQVESK-NMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHR 115

  Fly   460 VSPEVVDTVYIQGDVKL--WNVTLEK 483
            :.||.|..|.:..|:.|  :||:..|
Human   116 IKPEAVKMVQVWRDISLTKFNVSYLK 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galectinNP_608487.1 GLECT 143..262 CDD:238025
Gal-bind_lectin 339..479 CDD:278752 41/147 (28%)
CLCNP_001819.2 Gal-bind_lectin 5..137 CDD:278752 41/149 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150751
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D357844at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.