DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galectin and Grifin

DIOPT Version :10

Sequence 1:NP_608487.1 Gene:galectin / 33162 FlyBaseID:FBgn0031213 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_476535.2 Gene:Grifin / 117130 RGDID:71055 Length:144 Species:Rattus norvegicus


Alignment Length:156 Identity:43/156 - (27%)
Similarity:66/156 - (42%) Gaps:36/156 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 GKLSEGISFTVTGNLSVNCERFSINLVYNNDSRDVALHINPRLPQNYIVRNTKVQDIWGNEEVSS 208
            |.|:.|.|.||.|:.....::|.||.:  .|:.|:|.|:.||.....:|.|......||.|||||
  Rat    11 GGLAPGWSLTVQGHADAGEDKFEINFL--TDAGDIAFHVKPRFSSATVVGNAFQGGRWGQEEVSS 73

  Fly   209 ALPFLLSRGEEFSIQVLVTEACYMISVNGQHFAAYTHRIPYRDVRILEVKGDVSNVEMKRTLVLK 273
            ..|  |:.||.|.::|         |.:.:||..|..                   |.|   ||:
  Rat    74 VFP--LTLGEPFEVEV---------SADTEHFHIYAQ-------------------EQK---VLQ 105

  Fly   274 YPER-LPQSEANNIELHIDDGINEID 298
            :|.| .|.:....:.:..|..:.:::
  Rat   106 FPHRHRPLATITRVRVLSDHRLAQVE 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galectinNP_608487.1 GLECT 143..262 CDD:238025 35/117 (30%)
Gal-bind_lectin 346..479 CDD:459768
GrifinNP_476535.2 Gal-bind_lectin 11..131 CDD:459768 43/154 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.