DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galectin and Lgals2

DIOPT Version :9

Sequence 1:NP_608487.1 Gene:galectin / 33162 FlyBaseID:FBgn0031213 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_079898.2 Gene:Lgals2 / 107753 MGIID:895068 Length:130 Species:Mus musculus


Alignment Length:123 Identity:30/123 - (24%)
Similarity:61/123 - (49%) Gaps:5/123 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 LSEGISFTVTGNLSVNCERFSINLVYNNDSRDVALHINPRLPQNYIVRNTKVQDIWGNEEVSSAL 210
            :..|:|..:.|.:..:.:||.|||....::  :.||.|||..::.||.||.....||.|:..:.:
Mouse    12 MKPGMSLKIKGKIHNDVDRFLINLGQGKET--LNLHFNPRFDESTIVCNTSEGGRWGQEQRENHM 74

  Fly   211 PFLLSRGEEFSIQVLVTEACYMISVNGQHFAAYTHRIPYRDVRILEVKG-DVSNVEMK 267
            .|  |.|.|..|.:...:..:.:::...|...:.:|:.:..:..|.:.| .:|:.:::
Mouse    75 CF--SPGSEVKITITFQDKDFKVTLPDGHQLTFPNRLGHNQLHYLSMGGLQISSFKLE 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galectinNP_608487.1 GLECT 143..262 CDD:238025 29/116 (25%)
Gal-bind_lectin 339..479 CDD:278752
Lgals2NP_079898.2 GLECT 11..130 CDD:214596 30/121 (25%)
Beta-galactoside binding. /evidence=ECO:0000255 65..71 3/5 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11346
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.