DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galectin and Lgals2

DIOPT Version :10

Sequence 1:NP_608487.1 Gene:galectin / 33162 FlyBaseID:FBgn0031213 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_079898.2 Gene:Lgals2 / 107753 MGIID:895068 Length:130 Species:Mus musculus


Alignment Length:123 Identity:30/123 - (24%)
Similarity:61/123 - (49%) Gaps:5/123 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 LSEGISFTVTGNLSVNCERFSINLVYNNDSRDVALHINPRLPQNYIVRNTKVQDIWGNEEVSSAL 210
            :..|:|..:.|.:..:.:||.|||....::  :.||.|||..::.||.||.....||.|:..:.:
Mouse    12 MKPGMSLKIKGKIHNDVDRFLINLGQGKET--LNLHFNPRFDESTIVCNTSEGGRWGQEQRENHM 74

  Fly   211 PFLLSRGEEFSIQVLVTEACYMISVNGQHFAAYTHRIPYRDVRILEVKG-DVSNVEMK 267
            .|  |.|.|..|.:...:..:.:::...|...:.:|:.:..:..|.:.| .:|:.:::
Mouse    75 CF--SPGSEVKITITFQDKDFKVTLPDGHQLTFPNRLGHNQLHYLSMGGLQISSFKLE 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galectinNP_608487.1 GLECT 143..262 CDD:238025 29/116 (25%)
Gal-bind_lectin 346..479 CDD:459768
Lgals2NP_079898.2 GLECT 11..130 CDD:214596 30/121 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.