DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galectin and LOC105945375

DIOPT Version :10

Sequence 1:NP_608487.1 Gene:galectin / 33162 FlyBaseID:FBgn0031213 Length:503 Species:Drosophila melanogaster
Sequence 2:XP_031755300.1 Gene:LOC105945375 / 105945375 XenbaseID:XB-GENE-29088627 Length:140 Species:Xenopus tropicalis


Alignment Length:135 Identity:48/135 - (35%)
Similarity:76/135 - (56%) Gaps:16/135 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 AVPKYFNDQIGKLSEGISFTVTGNLSVNCERFSINL-VYNNDSRDVALHINPRLPQ-NYIVRNTK 196
            |:|       |.:..|::.|:.|.:..||:||::|. .:|||:   |.|.|||... |.||.||:
 Frog    15 AIP-------GGIRGGMTVTIDGTVFNNCKRFAVNFKCFNNDT---AFHFNPRFDDGNIIVCNTE 69

  Fly   197 VQDIWGNEEVSSALPFLLSRGEEFSIQVLVTEACYMISVNGQHFAAYTHRIPYRDVRILEVKGDV 261
            :.:.||:||..:.:||:  |...|.|.:.|.|..:.:||||.|...|.||:.|..:..|::.|::
 Frog    70 LGNKWGSEERMNHMPFI--RNRYFKINITVQEDVFQVSVNGNHVLHYRHRVSYHSINSLQLWGEI 132

  Fly   262 --SNV 264
              ||:
 Frog   133 TLSNI 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galectinNP_608487.1 GLECT 143..262 CDD:238025 44/122 (36%)
Gal-bind_lectin 346..479 CDD:459768
LOC105945375XP_031755300.1 Gal-bind_lectin 17..138 CDD:214904 47/133 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.