powered by:
Protein Alignment galectin and LOC101886033
DIOPT Version :9
Sequence 1: | NP_608487.1 |
Gene: | galectin / 33162 |
FlyBaseID: | FBgn0031213 |
Length: | 503 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_005173897.2 |
Gene: | LOC101886033 / 101886033 |
-ID: | - |
Length: | 245 |
Species: | Danio rerio |
Alignment Length: | 50 |
Identity: | 19/50 - (38%) |
Similarity: | 26/50 - (52%) |
Gaps: | 6/50 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 346 PNSLVDGRCLKIEGRVRLLPHSFYINLQQGQDIWPHPVIAFHLNPRFSKA 395
|..:.|...|.|.|:|:.....|.||..:|.| ||.|:|||||::
Zfish 199 PRGIYDKLMLTIRGQVKADAKMFTINFLRGND------IALHINPRFSES 242
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
galectin | NP_608487.1 |
GLECT |
143..262 |
CDD:238025 |
|
Gal-bind_lectin |
339..479 |
CDD:278752 |
19/49 (39%) |
LOC101886033 | XP_005173897.2 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D357844at33208 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.