DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galectin and lgals8b

DIOPT Version :9

Sequence 1:NP_608487.1 Gene:galectin / 33162 FlyBaseID:FBgn0031213 Length:503 Species:Drosophila melanogaster
Sequence 2:XP_021322933.1 Gene:lgals8b / 100334749 ZFINID:ZDB-GENE-120727-7 Length:320 Species:Danio rerio


Alignment Length:349 Identity:99/349 - (28%)
Similarity:152/349 - (43%) Gaps:67/349 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 LSEGISFTVTGNLSVNCERFSINLVYNNDSR---DVALHINPRLPQN-YIVRNTKVQDIWGNEEV 206
            |..|....:.|.:..|.:||..:|.....::   |||.|.|||...: .||.|....:.||.||.
Zfish    25 LHTGEMIIIQGCVQNNADRFQFDLTCGCSTKPRADVAFHFNPRFSSSPRIVCNFLHHENWGKEEN 89

  Fly   207 SSALPFLLSRGEEFSIQVLVTEACYMISVNGQHFAAYTHRIPYRDVRILEVKGDVSNVEMKRTLV 271
            ...:||  .:|..|...::|....:.::|||.|...|.||||...|....|.|            
Zfish    90 VDLMPF--KQGASFETIIMVLCDVFKVAVNGVHILEYKHRIPLEMVNTFSVSG------------ 140

  Fly   272 LKYPERLPQSEANNIELH----IDDGINEIDASVEETVKIPHEWCIISAPNTQSDS----SPKRN 328
                         |:|:|    |.|.:::|           |.||.|.........    :.|.:
Zfish   141 -------------NVEVHAIGFIPDSVSDI-----------HLWCNIFTHLILLFQICYYTGKFS 181

  Fly   329 NSSNDLGLTLPYYGALPPNSLVDGRCLKIEGRVRLLPHSFYINLQQGQDIWPHPVIAFHLNPRFS 393
            |||:   |::||.|:| ...::.|:.:.|:|.:.|.||||.:||:.||.    ..||.|:   :|
Zfish   182 NSSD---LSIPYKGSL-LRGVIPGQQITIKGHISLFPHSFTVNLRCGQS----NNIALHI---YS 235

  Fly   394 KASSGAIGKAVVCRNAWLNGAWAQEERSEFDTNFRPGRSFCLAIVCTKTSFEVYVNRQFMTDFKY 458
            ...||.:     .||:.|:.:|..|||......|..|..|.:.|:|....|::.||...:.|:.:
Zfish   236 HIKSGKL-----IRNSLLSQSWGPEERELPYFPFSAGNYFEIIILCQLHQFKIAVNGSHLLDYNH 295

  Fly   459 KVSP-EVVDTVYIQGDVKLWNVTL 481
            :|.. ..:|.:.|.||::|.:|.|
Zfish   296 RVQDLSSIDQLEILGDMELQHVQL 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galectinNP_608487.1 GLECT 143..262 CDD:238025 38/119 (32%)
Gal-bind_lectin 339..479 CDD:278752 44/140 (31%)
lgals8bXP_021322933.1 Gal-bind_lectin 22..147 CDD:214904 41/148 (28%)
Gal-bind_lectin 196..318 CDD:214904 40/133 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 72 1.000 Domainoid score I9258
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 122 1.000 Inparanoid score I4720
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D357844at33208
OrthoFinder 1 1.000 - - FOG0000178
OrthoInspector 1 1.000 - - mtm6433
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X133
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.