DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galectin and lgals2

DIOPT Version :9

Sequence 1:NP_608487.1 Gene:galectin / 33162 FlyBaseID:FBgn0031213 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001116913.1 Gene:lgals2 / 100144680 XenbaseID:XB-GENE-1032899 Length:131 Species:Xenopus tropicalis


Alignment Length:116 Identity:38/116 - (32%)
Similarity:57/116 - (49%) Gaps:4/116 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 KLSEGISFTVTGNLSVNCERFSINLVYNNDSRDVALHINPRLPQNYIVRNTKVQDIWGNEEVSSA 209
            :|..|.|..:.|.||.|.:.||.||  ...:.|:.||.||||.:|.||.|:|..:.|.:|:.|..
 Frog    11 ELKRGESLKIKGALSGNAKNFSFNL--GKSATDIGLHFNPRLHENTIVCNSKRSNNWESEQRSGH 73

  Fly   210 LPFLLSRGEEFSIQVLVTEACYMISVNGQHFAAYTHRIPYRDVRILEVKGD 260
            :.|  :.|.|..|.:......:.:.:...|...:.:|..|..:..|.||||
 Frog    74 MCF--TPGAEAKISIKFNGDNFEVKLPDGHEITFPNRHGYDKMTYLSVKGD 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galectinNP_608487.1 GLECT 143..262 CDD:238025 38/116 (33%)
Gal-bind_lectin 339..479 CDD:278752
lgals2NP_001116913.1 GLECT 12..129 CDD:238025 38/115 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11346
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.