DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dbr and CG31109

DIOPT Version :9

Sequence 1:NP_001245809.1 Gene:dbr / 33161 FlyBaseID:FBgn0067779 Length:1007 Species:Drosophila melanogaster
Sequence 2:NP_001262946.1 Gene:CG31109 / 43001 FlyBaseID:FBgn0051109 Length:198 Species:Drosophila melanogaster


Alignment Length:203 Identity:56/203 - (27%)
Similarity:92/203 - (45%) Gaps:36/203 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LCRICAANTKSKTNSVVESVFIFKTQG----LKDKISRHLYLNVAEEDPLPKVLCKSCYRQVEAT 68
            |||:|     |:.:..|  :.|:...|    |.:||:.:|.:.::..|||||.:||||..:||..
  Fly    13 LCRLC-----SEMHRTV--IHIYSDHGQRLCLVEKINGYLPITISPTDPLPKTICKSCLHRVEQH 70

  Fly    69 ASLSNIAKHTQL-VFRDFLLSTLPKNAREAAAAQL--------SVPATQIPHRHDEVQAEIDEFR 124
            .||  :.:.|:: ..|.|.|... |..|..:.:.:        |....:.|:|::|.||      
  Fly    71 YSL--LMRLTRMREERKFKLIKY-KAQRNPSISSVESEEDVINSSSVHEFPNRNEEDQA------ 126

  Fly   125 PILLTHVPESGNTASKPQPANCLELAPKTGENYLAASSSSSS--LSKPAGSVKSYLNTGRRNS-V 186
                |...||.:|.::..|......:||:.:..::..:||.|  .|....|.:....||..|| .
  Fly   127 ----TRRSESTSTQAETGPQTQESQSPKSTKTAVSTPNSSESHDASGAGPSNRDRKETGTGNSET 187

  Fly   187 FTDTRYGS 194
            .:.||.|:
  Fly   188 GSTTREGT 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dbrNP_001245809.1 zf-AD 8..84 CDD:214871 26/80 (33%)
CG31109NP_001262946.1 zf-AD 13..76 CDD:214871 25/71 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR39942
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.