DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HSPB2 and Hsp27

DIOPT Version :9

Sequence 1:NP_001532.1 Gene:HSPB2 / 3316 HGNCID:5247 Length:182 Species:Homo sapiens
Sequence 2:NP_001287001.1 Gene:Hsp27 / 39078 FlyBaseID:FBgn0001226 Length:213 Species:Drosophila melanogaster


Alignment Length:184 Identity:57/184 - (30%)
Similarity:82/184 - (44%) Gaps:49/184 - (26%)


- Green bases have known domain annotations that are detailed below.


Human     8 HAHPATAEYEFANPSR--------LGEQRFGEGLLPEEILTPTLYHGYYVRPRAAPAGEGSRAGA 64
            |||      :..:|.|        ||.:|:.    |.|     ..||::.:.....:|     |.
  Fly    34 HAH------DLFHPRRLLLPNTLGLGRRRYS----PYE-----RSHGHHNQMSRRASG-----GP 78

Human    65 SELRLSEGK--FQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSREFCRTYVLPADV 127
            :.|..:.||  ||..:|||.|.|:|:||:.|||.:.|..:|.:|.|.||.:.|.|.|.|.||...
  Fly    79 NALLPAVGKDGFQVCMDVSQFKPNELTVKVVDNTVVVEGKHEEREDGHGMIQRHFVRKYTLPKGF 143

Human   128 DPWRVRAALSHDGILNLEAPRGGRHLDTEVNEVYISLLPAPPDPEEEEEAAIVE 181
            ||..|.:.:|.||:|.|:|                   |.||..|:.:...||:
  Fly   144 DPNEVVSTVSSDGVLTLKA-------------------PPPPSKEQAKSERIVQ 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HSPB2NP_001532.1 alpha-crystallin-Hsps_p23-like 67..148 CDD:412199 37/82 (45%)
Hsp27NP_001287001.1 metazoan_ACD 86..163 CDD:107247 36/95 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
43.780

Return to query results.
Submit another query.