powered by:
Protein Alignment HSPB2 and CG14207
DIOPT Version :9
Sequence 1: | NP_001532.1 |
Gene: | HSPB2 / 3316 |
HGNCID: | 5247 |
Length: | 182 |
Species: | Homo sapiens |
Sequence 2: | NP_728275.1 |
Gene: | CG14207 / 32955 |
FlyBaseID: | FBgn0031037 |
Length: | 192 |
Species: | Drosophila melanogaster |
Alignment Length: | 69 |
Identity: | 30/69 - (43%) |
Similarity: | 47/69 - (68%) |
Gaps: | 1/69 - (1%) |
- Green bases have known domain annotations that are detailed below.
Human 79 DVSHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSREFCRTYVLPADVDPWRVRAALSHDGILN 143
|||.:.|:|:.|:|||..|.|.|:|.::.|... |.||:.|.::||..|:|..:|::||.||:|.
Fly 109 DVSQYAPEEIVVKTVDQKLLVHAKHEEKSDTKS-VYREYNREFLLPKGVNPESIRSSLSKDGVLT 172
Human 144 LEAP 147
::||
Fly 173 VDAP 176
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C165148895 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3591 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1187096at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.750 |
|
Return to query results.
Submit another query.