DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cda5 and Cht12

DIOPT Version :10

Sequence 1:NP_722590.2 Gene:Cda5 / 33158 FlyBaseID:FBgn0051973 Length:1998 Species:Drosophila melanogaster
Sequence 2:NP_726022.1 Gene:Cht12 / 246535 FlyBaseID:FBgn0050293 Length:470 Species:Drosophila melanogaster


Alignment Length:66 Identity:17/66 - (25%)
Similarity:24/66 - (36%) Gaps:8/66 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 NGPSFDCP--EEFGYYPHPS------DCTQYYVCVFGGALLESCTGGLMYSHDLQTCDWPRNVGC 108
            ||.:.:.|  |..|..||..      ||..|:.|..|..:...|..|..:..:...|.....|.|
  Fly   379 NGLTTEKPTTEASGLCPHDGFSRDGWDCRLYHECRDGERIYYECLEGQYFDENQIVCRPAAEVKC 443

  Fly   109 E 109
            :
  Fly   444 D 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cda5NP_722590.2 CBM_14 58..106 CDD:426342 13/55 (24%)
CE4_CDA_like_2 1664..1926 CDD:200597
Cht12NP_726022.1 GH18_chitinase-like 25..375 CDD:471972
ChtBD2 394..438 CDD:214696 10/43 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.