DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir21a and GLR1.3

DIOPT Version :9

Sequence 1:NP_001097043.1 Gene:Ir21a / 33157 FlyBaseID:FBgn0031209 Length:842 Species:Drosophila melanogaster
Sequence 2:NP_199652.1 Gene:GLR1.3 / 834896 AraportID:AT5G48410 Length:860 Species:Arabidopsis thaliana


Alignment Length:625 Identity:116/625 - (18%)
Similarity:210/625 - (33%) Gaps:222/625 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 ILENLFKTIPITFYHGEINADYEAKNKRFTSHIDCNCKSYILFLSDPLMTRKILGPQTESRVVLV 193
            :...|.:.|..|.::| ::.|::..:|:              .||:......::| .:|.||..:
plant   347 VTSTLLEEITKTRFNG-LSGDFQLNDKK--------------LLSNKFEIINMIG-SSERRVGFL 395

  Fly   194 SRSTQWRLRDFLSSELSSNIVNLLV---------IGESLMADPMRERPYVLYTHKLYADGLGSNT 249
            :.:..:..|..|||  :.|.:..::         .|.||: |..|::..||.|..          
plant   396 NSNGSFSNRRHLSS--THNKLETIIWPGGSAQSPKGTSLI-DSDRKKLRVLVTSS---------- 447

  Fly   250 PVVLTSWIKGALSRPHINLFPSKFQF------------GFAGHRFQISAANQPPFIFRIRTLDSS 302
                             |.||...:.            ||.   .::..|:..||.:.:..:  .
plant   448 -----------------NRFPRLMKVETDPVTNELIVEGFC---IEVFRASISPFNYEVEYI--P 490

  Fly   303 GMGQLRWDGVEFRLLTMISKRLNFSIDITETPTRSNTRGVVDTIQEQIIERTV---DIGMSGIYI 364
            .:....:|.:.:.|.:...|......|||.|..||.           .::.|:   ::|: ||..
plant   491 WLNGSNYDNLAYALHSQKDKYDAAVGDITITSNRST-----------YVDFTLPFTEMGL-GIVA 543

  Fly   365 TQERLMDSAMSVGHSPDCAAFITLASKALPKYRAIMGPFQWPVWVALICVYLGGIFPIVFTDRLT 429
            .:||    :|.|...|                   :.|..| :..|...|..|.|..::  :|..
plant   544 VKER----SMWVFFQP-------------------LTPDLW-ITSAFFFVLTGVIVWLI--ERAE 582

  Fly   430 LSHLMGNW-GEVENMFWYVFGMFTNAFSFTGKYSWSNTRKNSTRLLIGAYWLFTI-IITSCYTGS 492
            .....|:| .::..:.|  ||..|..::...|     .:.|.:|.:: ..|:|.: |:|:.||.:
plant   583 NKEFQGSWPQQIGVVLW--FGFSTLVYAHREK-----LKHNLSRFVV-TVWVFAVLILTASYTAT 639

  Fly   493 IIAFVTLP--AFPDTVDSVLDLLGLFFRVGTLNNGGWETWFQNSTHIPTSRLYKKMEFVG---SV 552
            :.:.:|:.  .|....|.|..|.|.......|                ||...:.|..:|   :.
plant   640 LTSMMTVQQIRFNSNEDYVGHLSGSLIANVAL----------------TSSSLRAMRSLGLNSAA 688

  Fly   553 D--EGIGNVTQSFFWNYAFLGSKAQLEYLVQSNFSDENISRRSALHLSEECFALFQI-------- 607
            |  :.:.|.|.||..:        :|.||              .:.|.|.....|.:        
plant   689 DYAQALLNKTVSFVVD--------ELPYL--------------KVVLGENPTHFFMVKTQSTTNG 731

  Fly   608 -GFLFPRESVYKIKIDSMILLAQQSG--LIAKINNEVSWVMQRSSSGRLLQASSSNSLREIIQE- 668
             ||:|                  |.|  |:..::.|:|            :..:|..|.|:.:. 
plant   732 FGFMF------------------QKGFELVPNVSREIS------------KLRTSEKLNEMEKRW 766

  Fly   669 -ERQL--TTADT---------EGMFLLMALGYFLGATALV 696
             :.||  ||.||         .|:|:::.:.:......||
plant   767 FDNQLPYTTDDTSNPITLYRFRGLFIIIGVSFAFALAVLV 806

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir21aNP_001097043.1 Periplasmic_Binding_Protein_Type_2 289..583 CDD:304360 61/305 (20%)
Lig_chan 407..662 CDD:278489 51/274 (19%)
GLR1.3NP_199652.1 PBP1_GABAb_receptor 43..405 CDD:107361 12/73 (16%)
ANF_receptor 57..385 CDD:279440 8/52 (15%)
GluR_Plant 438..767 CDD:270404 84/474 (18%)
Lig_chan 559..798 CDD:278489 62/317 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18966
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.