DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir21a and GLR2.4

DIOPT Version :9

Sequence 1:NP_001097043.1 Gene:Ir21a / 33157 FlyBaseID:FBgn0031209 Length:842 Species:Drosophila melanogaster
Sequence 2:NP_001328410.1 Gene:GLR2.4 / 829299 AraportID:AT4G31710 Length:912 Species:Arabidopsis thaliana


Alignment Length:266 Identity:53/266 - (19%)
Similarity:95/266 - (35%) Gaps:71/266 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   406 PVWVALICVYLGGIFPIVFTDRLTLSHLMGN------WGEVENMFWYVFGMFTNA-----FSFTG 459
            |:...|..:.||..|.:.|...: |.|.:.:      ..::..|||:.|.:...|     .||| 
plant   579 PLTPGLWGMTLGSFFVVGFVVWI-LEHRVNSEFTGPPQYQISTMFWFAFSIMVFAPRERVMSFT- 641

  Fly   460 KYSWSNTRKNSTRLLIGAYWLFTIIITSCYTGSIIAFVTLPAFPDTVDSVLDLLGL--------- 515
                       .|:::..::...:::|..||.|:.:.:|......|..|:.::|..         
plant   642 -----------ARVVVITWYFIVLVLTQSYTASLSSLLTTQQLNPTETSIKNVLAKGGPVAYQRD 695

  Fly   516 FFRVGTLNNGGWETWFQNSTHIPTSRLY-----KKMEFVGSVDEGIGNVTQSFF---WNYAFLGS 572
            .|.:|.|...|:          |.|||.     :|.|.:.:.....|.|:.:|.   :...|||.
plant   696 SFVLGKLRESGF----------PESRLVPFTSPEKCEELLNKGPSKGGVSAAFMEVPYVRVFLGQ 750

  Fly   573 KAQLEYLVQSNFSDENISRRSALHLSEECFALFQIGFLFPRESVYKIKIDSMILLAQQSGLIAKI 637
            ..:...:|:..|..:.                  .||:||..|.....:...||...:|....::
plant   751 YCKKYKMVEVPFDVDG------------------FGFVFPIGSPLVADVSRAILKVAESNKATQL 797

  Fly   638 NNEVSW 643
              |.:|
plant   798 --ETAW 801

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir21aNP_001097043.1 Periplasmic_Binding_Protein_Type_2 289..583 CDD:304360 42/204 (21%)
Lig_chan 407..662 CDD:278489 52/265 (20%)
GLR2.4NP_001328410.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18966
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.