DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir21a and C08B6.5

DIOPT Version :9

Sequence 1:NP_001097043.1 Gene:Ir21a / 33157 FlyBaseID:FBgn0031209 Length:842 Species:Drosophila melanogaster
Sequence 2:NP_505601.1 Gene:C08B6.5 / 182390 WormBaseID:WBGene00007426 Length:423 Species:Caenorhabditis elegans


Alignment Length:440 Identity:75/440 - (17%)
Similarity:147/440 - (33%) Gaps:159/440 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 GVEFRLLTMISKRLNFSIDITETPTRSNTRGVVDTIQEQIIERTVDIGMSGI--YITQERLMDSA 373
            |.|..:::|:.:.|::..::.:|....|.  |.|....|     .|...|||  .:.|:::..|.
 Worm    10 GAEIEIISMVMQILDWQWEVIDTEKEFNV--VNDFGNPQ-----PDGNFSGIMGLLAQDKIDMSG 67

  Fly   374 MSVGHSPDCAAFITLASKALP-KY----------------RAIMGPFQWPVWVALICVYLGGIFP 421
            :|:..:|   |.:..|....| :|                ..:..||...:|:.|:...:|    
 Worm    68 LSMRITP---ARMEFAHFTFPIRYFQQVYIIKRPAENDFRNFVFAPFTTDMWLLLLATIMG---- 125

  Fly   422 IVFTDRLTLSHLMGNWGEVENMFW-----YVFGMFTNA----FSFTGKYSWSNTRKNSTRLLIGA 477
             ..|.|...:           ::|     ..|.::|::    |....|....:....||.||.|.
 Worm   126 -ASTMRFACA-----------LYWDSRVGSKFNIYTSSVLETFGLMLKQRVQDPTAVSTMLLEGF 178

  Fly   478 YWLFTIIITSCYTGSIIAFVTLPAFPDTVDSVLDLLGLFFRVGTLNNGGWETWFQNSTHIPTSRL 542
            ..:..:.|...|..|:.:.:|.|.                                |:.||....
 Worm   179 LIVAMMSIAQYYQTSMNSRLTAPP--------------------------------SSRIPFLHQ 211

  Fly   543 YKKMEFVGSVDEGIGNVTQSFFWNYAFLGSKAQLEYLVQSNFSDENISRRSALHLSEECFALFQI 607
            .:.:|.:  :|:   ....::::|....||..:.||         ||.|..|:            
 Worm   212 NQLIELL--LDK---ETYLTYYFNLTLEGSTEKNEY---------NIKRALAM------------ 250

  Fly   608 GFLFPRESVYKIKIDSMILLAQQSGLIAKINN--------EVSWVMQRSSSGRLLQASSSNSLRE 664
                          :.:::.|:::.||.:|..        ::.::.|..|               
 Worm   251 --------------NPIVVRAREADLIKEIQKGGVFYSTYDIEFLPQAVS--------------- 286

  Fly   665 IIQEERQLTTA--DTEGMFLLMALGYFLGATAL-------VSEIVGGITN 705
             :.::||..|.  ||.|:...:|.|:.:....|       :.:|:.||.:
 Worm   287 -VWDKRQGLTVIRDTSGILSYVAFGFSISNRKLCQMFNKALLKILPGIAS 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir21aNP_001097043.1 Periplasmic_Binding_Protein_Type_2 289..583 CDD:304360 53/299 (18%)
Lig_chan 407..662 CDD:278489 40/271 (15%)
C08B6.5NP_505601.1 Periplasmic_Binding_Protein_Type_2 13..>116 CDD:304360 21/112 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.