DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)gl and Stxbp6

DIOPT Version :10

Sequence 1:NP_523439.2 Gene:l(2)gl / 33156 FlyBaseID:FBgn0002121 Length:1161 Species:Drosophila melanogaster
Sequence 2:NP_001178801.1 Gene:Stxbp6 / 362734 RGDID:1306117 Length:210 Species:Rattus norvegicus


Alignment Length:142 Identity:33/142 - (23%)
Similarity:52/142 - (36%) Gaps:51/142 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   997 TYACDEVVNTYEIKNPSGISICTRPAEEN----VGRN-----SVQQVNGVNISNSPNQANETISS 1052
            ||.|..|.|    |.|:..||......|.    |.|:     .::||||::    ||:     .|
  Rat    46 TYICLSVTN----KKPTQASITKVKQFEGSTSFVRRSQWMLEQLRQVNGID----PNR-----DS 97

  Fly  1053 SIGDITVDSVRDH-LNMTTTTLCS--------------------INTEETI-GRLSVL------- 1088
            :..|:..::..|. :..|.:..|:                    ||.:..| |..|:|       
  Rat    98 AEFDLLFENAFDQWVASTASEKCTFFQILHHTCQRYLTDRKPEFINCQSKIMGGNSILHSAADSV 162

  Fly  1089 STQTNKASTTVN 1100
            ::...|||..:|
  Rat   163 TSAVQKASQALN 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)glNP_523439.2 WD40 repeat 39..78 CDD:293791
WD40 repeat 84..126 CDD:293791
WD40 repeat 131..174 CDD:293791
WD40 repeat 188..224 CDD:293791
LLGL 268..>338 CDD:462446
Stxbp6NP_001178801.1 PH-STXBP6 2..131 CDD:270200 23/97 (24%)
R-SNARE_STXBP6 149..210 CDD:277245 7/26 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.