DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)gl and Stxbp6

DIOPT Version :9

Sequence 1:NP_001245801.1 Gene:l(2)gl / 33156 FlyBaseID:FBgn0002121 Length:1161 Species:Drosophila melanogaster
Sequence 2:NP_001178801.1 Gene:Stxbp6 / 362734 RGDID:1306117 Length:210 Species:Rattus norvegicus


Alignment Length:142 Identity:33/142 - (23%)
Similarity:52/142 - (36%) Gaps:51/142 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   997 TYACDEVVNTYEIKNPSGISICTRPAEEN----VGRN-----SVQQVNGVNISNSPNQANETISS 1052
            ||.|..|.|    |.|:..||......|.    |.|:     .::||||::    ||:     .|
  Rat    46 TYICLSVTN----KKPTQASITKVKQFEGSTSFVRRSQWMLEQLRQVNGID----PNR-----DS 97

  Fly  1053 SIGDITVDSVRDH-LNMTTTTLCS--------------------INTEETI-GRLSVL------- 1088
            :..|:..::..|. :..|.:..|:                    ||.:..| |..|:|       
  Rat    98 AEFDLLFENAFDQWVASTASEKCTFFQILHHTCQRYLTDRKPEFINCQSKIMGGNSILHSAADSV 162

  Fly  1089 STQTNKASTTVN 1100
            ::...|||..:|
  Rat   163 TSAVQKASQALN 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)glNP_001245801.1 WD40 repeat 39..78 CDD:293791
WD40 repeat 84..126 CDD:293791
WD40 repeat 131..174 CDD:293791
WD40 repeat 188..224 CDD:293791
LLGL 268..>338 CDD:285555
Stxbp6NP_001178801.1 PH-STXBP6 2..131 CDD:270200 23/97 (24%)
R-SNARE_STXBP6 149..210 CDD:277245 7/26 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1983
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.