DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HSPB1 and Hsp27

DIOPT Version :9

Sequence 1:NP_001531.1 Gene:HSPB1 / 3315 HGNCID:5246 Length:205 Species:Homo sapiens
Sequence 2:NP_001287001.1 Gene:Hsp27 / 39078 FlyBaseID:FBgn0001226 Length:213 Species:Drosophila melanogaster


Alignment Length:139 Identity:56/139 - (40%)
Similarity:79/139 - (56%) Gaps:7/139 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    65 SPAVAAPAYSRALSRQLSSGVSEIRHTA--DRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEER 127
            ||...:..:...:||:.|.|.:.:....  |.::|.:||:.|.|:|||||..|..|.:.||||||
  Fly    58 SPYERSHGHHNQMSRRASGGPNALLPAVGKDGFQVCMDVSQFKPNELTVKVVDNTVVVEGKHEER 122

Human   128 QDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQS-NEITIPVTFESRAQL 191
            :|.||.|.|.|.||||||.|.||.:|.|::|.:|.||::||.|....|: :|..:.:.....|.|
  Fly   123 EDGHGMIQRHFVRKYTLPKGFDPNEVVSTVSSDGVLTLKAPPPPSKEQAKSERIVQIQQTGPAHL 187

Human   192 G----GPEA 196
            .    .|||
  Fly   188 SVKAPAPEA 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HSPB1NP_001531.1 Interaction with TGFB1I1. /evidence=ECO:0000250 70..205 54/134 (40%)
ACD_HspB1_like 84..169 CDD:107230 42/86 (49%)
Hsp27NP_001287001.1 metazoan_ACD 86..163 CDD:107247 40/76 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.