DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HSPB1 and Hsp23

DIOPT Version :9

Sequence 1:NP_001531.1 Gene:HSPB1 / 3315 HGNCID:5246 Length:205 Species:Homo sapiens
Sequence 2:NP_001246694.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster


Alignment Length:131 Identity:54/131 - (41%)
Similarity:79/131 - (60%) Gaps:9/131 - (6%)


- Green bases have known domain annotations that are detailed below.


Human    75 RALSRQL-----SSG-VSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGY 133
            |.|.:|:     ||| ||:|  ..|.::|.:||:||.|.||.||.:|..|.:.|.||||:|:||:
  Fly    47 RQLEKQVGASSGSSGAVSKI--GKDGFQVCMDVSHFKPSELVVKVQDNSVLVEGNHEEREDDHGF 109

Human   134 ISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPM-PKLATQSNEITIPVTFESRAQLGGPEAA 197
            |:|.|.|:|.||||.:..:|:|:||.:|.||::.|. |.:..:.||..:.:.....|.|...|..
  Fly   110 ITRHFVRRYALPPGYEADKVASTLSSDGVLTIKVPKPPAIEDKGNERIVQIQQVGPAHLNVKENP 174

Human   198 K 198
            |
  Fly   175 K 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HSPB1NP_001531.1 Interaction with TGFB1I1. /evidence=ECO:0000250 70..205 54/131 (41%)
ACD_HspB1_like 84..169 CDD:107230 41/85 (48%)
Hsp23NP_001246694.1 metazoan_ACD 67..145 CDD:107247 37/77 (48%)
IbpA <69..161 CDD:223149 41/91 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101545
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5925
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.