DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HSPB1 and Hsp67Ba

DIOPT Version :9

Sequence 1:NP_001531.1 Gene:HSPB1 / 3315 HGNCID:5246 Length:205 Species:Homo sapiens
Sequence 2:NP_523998.1 Gene:Hsp67Ba / 39076 FlyBaseID:FBgn0001227 Length:445 Species:Drosophila melanogaster


Alignment Length:105 Identity:47/105 - (44%)
Similarity:66/105 - (62%) Gaps:14/105 - (13%)


- Green bases have known domain annotations that are detailed below.


Human    66 PAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDE 130
            ||.:..||| .::|             :.::||::|..||.:||||||.|..:.:.|:|:|::|.
  Fly   112 PAASKSAYS-VVNR-------------NGFQVSMNVKQFAANELTVKTIDNCIVVEGQHDEKEDG 162

Human   131 HGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMP 170
            ||.|||.|.|||.||.|.||.:|.|:||.:|.|||:||.|
  Fly   163 HGVISRHFIRKYILPKGYDPNEVHSTLSSDGILTVKAPPP 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HSPB1NP_001531.1 Interaction with TGFB1I1. /evidence=ECO:0000250 70..205 45/101 (45%)
ACD_HspB1_like 84..169 CDD:107230 39/84 (46%)
Hsp67BaNP_523998.1 metazoan_ACD 124..200 CDD:107247 39/88 (44%)
DNA_pol3_delta2 <218..>381 CDD:331068
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6558
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.