DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HSPB1 and Hsp26

DIOPT Version :9

Sequence 1:NP_001531.1 Gene:HSPB1 / 3315 HGNCID:5246 Length:205 Species:Homo sapiens
Sequence 2:NP_001287000.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster


Alignment Length:210 Identity:64/210 - (30%)
Similarity:87/210 - (41%) Gaps:46/210 - (21%)


- Green bases have known domain annotations that are detailed below.


Human    12 RGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPL--------------PPAA 62
            |.|.::.....:||||                          ||.||              .|..
  Fly    17 RSPIYELGLGLHPHSR--------------------------YVLPLGTQQRRSINGCPCASPIC 55

Human    63 IESPAVAAPAYSRALSRQLSSGVSEIRHTA-DRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEE 126
            ..|||....|..|.::.:.........|.. |.::|.:||..|.|.||.||..|..:.:.|||||
  Fly    56 PSSPAGQVLALRREMANRNDIHWPATAHVGKDGFQVCMDVAQFKPSELNVKVVDDSILVEGKHEE 120

Human   127 RQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPK-LATQSNEITIPVTFESRAQ 190
            |||:||:|.|.|.|:|.:|.|....||.|.||.:|.|||..|.|: :..:|.|..|.:.....|.
  Fly   121 RQDDHGHIMRHFVRRYKVPDGYKAEQVVSQLSSDGVLTVSIPKPQAVEDKSKERIIQIQQVGPAH 185

Human   191 LGGPEAAKSDETAAK 205
            |.    .|::|:..|
  Fly   186 LN----VKANESEVK 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HSPB1NP_001531.1 Interaction with TGFB1I1. /evidence=ECO:0000250 70..205 49/136 (36%)
ACD_HspB1_like 84..169 CDD:107230 38/85 (45%)
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 37/77 (48%)
IbpA <87..179 CDD:223149 42/91 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6558
SonicParanoid 1 1.000 - - X5925
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.