DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HSPB1 and Hsp67Bc

DIOPT Version :9

Sequence 1:NP_001531.1 Gene:HSPB1 / 3315 HGNCID:5246 Length:205 Species:Homo sapiens
Sequence 2:NP_523994.1 Gene:Hsp67Bc / 39071 FlyBaseID:FBgn0001229 Length:199 Species:Drosophila melanogaster


Alignment Length:137 Identity:49/137 - (35%)
Similarity:68/137 - (49%) Gaps:15/137 - (10%)


- Green bases have known domain annotations that are detailed below.


Human    76 ALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTR 140
            ||||   .|.|   :....:.|.|||..|.|.|||||..:..:.:.||||||:|:||::||.|.|
  Fly    68 ALSR---GGAS---NKQGNFEVHLDVGLFQPGELTVKLVNECIVVEGKHEEREDDHGHVSRHFVR 126

Human   141 KYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQL---------GGPEA 196
            :|.||...|...:.|:||.:|.|.:..|......:..|..||:.....:.|         .||.|
  Fly   127 RYPLPKEFDSDAIVSTLSEDGVLNITVPPLVSKEELKERIIPIKHVGPSDLFQNGNGHKEAGPAA 191

Human   197 AKSDETA 203
            :.|:..|
  Fly   192 SASEPEA 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HSPB1NP_001531.1 Interaction with TGFB1I1. /evidence=ECO:0000250 70..205 49/137 (36%)
ACD_HspB1_like 84..169 CDD:107230 35/84 (42%)
Hsp67BcNP_523994.1 metazoan_ACD 75..154 CDD:107247 34/81 (42%)
IbpA <79..170 CDD:223149 37/90 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.