DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HSPB1 and l(2)efl

DIOPT Version :9

Sequence 1:NP_001531.1 Gene:HSPB1 / 3315 HGNCID:5246 Length:205 Species:Homo sapiens
Sequence 2:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster


Alignment Length:203 Identity:77/203 - (37%)
Similarity:105/203 - (51%) Gaps:43/203 - (21%)


- Green bases have known domain annotations that are detailed below.


Human    19 FRDWYPH-------SRLFDQAF--GLPRLPEEWSQWLGGSSWP-----GYVRPLPPAAIESPAVA 69
            ||||:..       |||.||.|  ||.|.....|.|   :|.|     ||:||.           
  Fly     8 FRDWWDELDFPMRTSRLLDQHFGQGLKRDDLMSSVW---NSRPTVLRSGYLRPW----------- 58

Human    70 APAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYI 134
               ::.:|.:|.|.  |.:...::::.|.|||..|:|.|:|||..|..|.:.|||||:||||||:
  Fly    59 ---HTNSLQKQESG--STLNIDSEKFEVILDVQQFSPSEITVKVADKFVIVEGKHEEKQDEHGYV 118

Human   135 SRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEA--- 196
            ||.|:|:|.||..|:|..|:||||.:|.||::|||..|.....|..:.:|      ..||.:   
  Fly   119 SRQFSRRYQLPSDVNPDTVTSSLSSDGLLTIKAPMKALPPPQTERLVQIT------QTGPSSKED 177

Human   197 -AKSDETA 203
             ||..||:
  Fly   178 NAKKVETS 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HSPB1NP_001531.1 Interaction with TGFB1I1. /evidence=ECO:0000250 70..205 56/138 (41%)
ACD_HspB1_like 84..169 CDD:107230 42/84 (50%)
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 41/81 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101545
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6558
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.