Sequence 1: | NP_001531.1 | Gene: | HSPB1 / 3315 | HGNCID: | 5246 | Length: | 205 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001027114.1 | Gene: | Hsp22 / 3772576 | FlyBaseID: | FBgn0001223 | Length: | 174 | Species: | Drosophila melanogaster |
Alignment Length: | 195 | Identity: | 54/195 - (27%) |
---|---|---|---|
Similarity: | 81/195 - (41%) | Gaps: | 58/195 - (29%) |
- Green bases have known domain annotations that are detailed below.
Human 27 RLFDQAFGLPRL----------PEEWS-----QWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRA 76
Human 77 LSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKD-GVVEITGKHEERQDEH-GYISRCFT 139
Human 140 RKYTLPPGVDPTQVSSSLSPEGTLTVEAPMP---KLATQSNEITIPVTFESRAQLGGPEAAKSDE 201
Human 202 201 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
HSPB1 | NP_001531.1 | Interaction with TGFB1I1. /evidence=ECO:0000250 | 70..205 | 42/137 (31%) | |
ACD_HspB1_like | 84..169 | CDD:107230 | 31/86 (36%) | ||
Hsp22 | NP_001027114.1 | IbpA | 17..154 | CDD:223149 | 46/166 (28%) |
metazoan_ACD | 61..138 | CDD:107247 | 31/105 (30%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3591 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |