DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fog and Necap2

DIOPT Version :9

Sequence 1:NP_001033860.1 Gene:fog / 33148 FlyBaseID:FBgn0000719 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_079659.1 Gene:Necap2 / 66147 MGIID:1913397 Length:266 Species:Mus musculus


Alignment Length:262 Identity:59/262 - (22%)
Similarity:92/262 - (35%) Gaps:67/262 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 DWVNLDPEQRNLTKEKKITAK-SIFTLPFRHCPQGHTLFNQLCI---PQSNIDP-TDLVKQELIL 100
            :| .||  |.:.:...:|||| .:..:.......|. ||.|..:   |.:.::. ||..:..:|.
Mouse    34 EW-QLD--QPSWSGRLRITAKGKVAYIKLEDRTSGE-LFAQAPVDQFPGTAVESVTDSSRYFVIR 94

  Fly   101 AGGSNGSPPPPPIGDYDYGDDEESEEIVYDLSVIPTAMQD---GLPPSVGTGDQALPSEDAP--- 159
            ....||......:|..|.||       .:|.:|   |:||   .:........||...::.|   
Mouse    95 IEDGNGRRAFIGLGFGDRGD-------AFDFNV---ALQDHFKWVKQQCEFAKQAQNPDEGPKLD 149

  Fly   160 --------LKFNI--FEKK---------FPTGTGEHEEMPLPPDMAAATYAKNISTTPETSTSIT 205
                    :|.||  ..||         .||..|....:|.||.             .::||.|.
Mouse   150 LGFKDGQTIKINIANMRKKEGAAGTPRARPTSAGGLSLLPPPPG-------------GKSSTVIP 201

  Fly   206 PTSTT-----TFAVPSVPSGE--ASNRIPGGVDLLAAPSDAFSTSTTLSMPTSNTTTTSNKDIGQ 263
            |:...     :...|:|.||.  |:...|......||.:|.:...|   ..|.:.::.|....|.
Mouse   202 PSGEQLSVGGSLVQPAVVSGSGGATELWPQSKPAAAATADIWGDFT---KSTGSPSSQSQPGTGW 263

  Fly   264 VE 265
            |:
Mouse   264 VQ 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fogNP_001033860.1 FOG_N 58..166 CDD:292512 29/128 (23%)
Necap2NP_079659.1 DUF1681 6..162 CDD:400335 31/141 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 165..198 8/45 (18%)
WXXF motif 1 243..246 0/2 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 245..266 5/24 (21%)
WXXF motif 2 263..266 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.