DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fog and necap2

DIOPT Version :9

Sequence 1:NP_001033860.1 Gene:fog / 33148 FlyBaseID:FBgn0000719 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_001230093.1 Gene:necap2 / 553536 ZFINID:ZDB-GENE-050522-67 Length:260 Species:Danio rerio


Alignment Length:235 Identity:55/235 - (23%)
Similarity:75/235 - (31%) Gaps:67/235 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 LFNQLCI---PQSNIDP-TDLVKQELILAGGSNGSPPPPPIGDYDYGDDEESEEIVYDLSVI--- 134
            ||.|..:   |.|.::. .|..:..:|.....||......:|..|.||.       :|.:|.   
Zfish    70 LFAQAAVEQYPSSVVEAVVDSSRYFVIRIEDGNGRHAFIGLGFADRGDS-------FDFNVALQD 127

  Fly   135 ---------PTAMQDGLPPSVGTGDQALPSEDAPLKFNIFEKKFPTGTGEHEEMPLPPDMAAATY 190
                     ..|.|:.:..||...|... .|...:|.||...|.....|     ||....||.  
Zfish   128 HFKWVKQESDLARQEAVQDSVPKLDLGF-KEGQTIKINIGNMKKKESGG-----PLRSRAAAG-- 184

  Fly   191 AKNISTTPETSTSITPTSTTTFAVPSVPSGEASNRIPGGVDLLAAPSDAFSTSTTLSMPTSNTTT 255
                                  .:|..|:|:|...:|        |..|.:|:||...|.|..|.
Zfish   185 ----------------------LLPPPPAGKAGAVLP--------PPAAHTTTTTAPAPPSTGTL 219

  Fly   256 TSNKDIGQVESIVLPADQEHDGLVHLVTSSLSDNDSDDSS 295
            .   |.|....||.|..|:..|   ..||:.|.:..|..|
Zfish   220 L---DFGDSAPIVAPPSQDMWG---DFTSAGSGSAQDSRS 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fogNP_001033860.1 FOG_N 58..166 CDD:292512 24/104 (23%)
necap2NP_001230093.1 DUF1681 9..166 CDD:285210 23/103 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
10.960

Return to query results.
Submit another query.