DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cda4 and Chi3l1

DIOPT Version :9

Sequence 1:NP_728468.1 Gene:Cda4 / 33144 FlyBaseID:FBgn0052499 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001296749.1 Gene:Chi3l1 / 89824 RGDID:620874 Length:391 Species:Rattus norvegicus


Alignment Length:217 Identity:42/217 - (19%)
Similarity:77/217 - (35%) Gaps:54/217 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 GTE------SISQQQGLQDKGYEEWVGEMIGMREILRH--FANVSVND-------VVGMRAPFLK 241
            |||      ::|..:...|.||:        :.:|.:|  |.|:...|       ..|..:|..:
  Rat   176 GTEKLLLSAAVSAGKVTLDSGYD--------VAQIAQHLDFINLMTYDFHGTWRHTTGHHSPLFR 232

  Fly   242 PGRNT---QYKVLEDFGYIYDSSITVPP----VPVPVWPYTLDYKISHECKSGTCPSRTFPGVWE 299
            ..::|   ::..: |:|..|...:..|.    :.:|.:..:.....|.............||.:.
  Rat   233 GQQDTGPDRFSNV-DYGVGYMLRLGAPTNKLVMGIPTFGKSFTLASSENQVGAPITGSGLPGRYT 296

  Fly   300 VPLNTHYVEGYEGGHCPYLDQCVLHNLDEEEV------FQWLQEDFSRYYEQNKAPYMMPFHTNW 358
            ....|  :..||  .|.:|....:|.:..::|      .||:..|..... :||..|:       
  Rat   297 KEKGT--LAYYE--ICDFLRGAEVHRILGQQVPFATKGNQWVGYDDPESV-KNKVKYL------- 349

  Fly   359 FQTKPLENGLHKFLDWALELPD 380
             :.|.|...    :.||::|.|
  Rat   350 -KNKQLAGA----MVWAVDLDD 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cda4NP_728468.1 CBM_14 33..80 CDD:279884
CE4_CDA_like_1 130..396 CDD:200596 42/217 (19%)
Chi3l1NP_001296749.1 Glyco_18 31..365 CDD:214753 40/214 (19%)
GH18_chitolectin_chitotriosidase 32..388 CDD:119351 42/217 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350353
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.