DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Cda4 and Cht4

DIOPT Version :9

Sequence 1:	NP_728468.1	Gene:	Cda4 / 33144	FlyBaseID:	FBgn0052499	Length:	486	Species:	Drosophila melanogaster
Sequence 2:	NP_524962.2	Gene:	Cht4 / 49815	FlyBaseID:	FBgn0022700	Length:	462	Species:	Drosophila melanogaster

Alignment Length:	59	Identity:	18/59 - (30%)
Similarity:	27/59 - (45%)	Gaps:	7/59 - (11%)

- Green bases have known domain annotations that are detailed below.

  Fly    14 TGANGQGKEKEEFQCPSHIANGNYADPATCRRFYQCVDGYPYLNRCPSGLFFDDVQKFC 72
            |...|.|..    :|..   :|.:...:.|.:|||||.|..|..:|.:||.|:.:...|
  Fly   408 TPGGGSGGN----ECAQ---DGFFVLESDCNKFYQCVGGVRYDFQCGAGLCFNTITLNC 459

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Cda4	NP_728468.1	CBM_14	33..80	CDD:279884	14/40 (35%)
Cda4	NP_728468.1	CE4_CDA_like_1	130..396	CDD:200596
Cht4	NP_524962.2	GH18_chitolectin_chitotriosidase	26..371	CDD:119351
		Glyco_18	28..351	CDD:214753
		CBM_14	421..462	CDD:279884	14/39 (36%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C45463785
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	0.930